PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA002005-PA
Common NameOsI_01152
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 353aa    MW: 38458.7 Da    PI: 9.547
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA002005-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK71.11.5e-224085449
            RWP-RK  4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRki 49
                      ++s e++sk Fslpi++AA+ Lgvc++vLKriCR +GI RWP+Rk+
  BGIOSGA002005-PA 40 SLSYEEISKLFSLPIAEAASILGVCTSVLKRICRSHGIVRWPYRKL 85
                      6899*****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.7923108IPR003035RWP-RK domain
PfamPF020429.9E-214185IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MASTAQPQQQ QEQQPVAAAA VPTPAPPASE AQPQKPTRVS LSYEEISKLF SLPIAEAASI  60
LGVCTSVLKR ICRSHGIVRW PYRKLLTELL LRNKRPSSEA SITAPVASGM HLVRALIENW  120
RWQPLPWRKQ TEDMLVSGKS GDDTKNAERE KAKGLLEISK VAKQKALSAS GLSTVRFPRS  180
GKISTGKFEG RTSLTPRKTK CVGWISILSY GTQTKGIPNY MDDFKYGFPS SGLSLQTMKW  240
WGTDSHTETT PAKDDNGEAP ESANEASKGM TDDELDWGAD EAEAEADADS AITTEPSAQL  300
CSLRRKAVDD GRKLLTGKSC GGLELCRLNK RQKMALAQVF GASLPEQLRS KLG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.17790.0callus| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329690020.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0589840.0AK058984.1 Oryza sativa Japonica Group cDNA clone:001-020-E04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625714.11e-156PREDICTED: uncharacterized protein LOC4326758
TrEMBLB8ABT80.0B8ABT8_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA002005-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67053242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.12e-09RWP-RK domain-containing protein